DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nkt and Ptprf

DIOPT Version :9

Sequence 1:	NP_648450.3	Gene:	nkt / 39264	FlyBaseID:	FBgn0036146	Length:	162	Species:	Drosophila melanogaster
Sequence 2:	XP_006502927.1	Gene:	Ptprf / 19268	MGIID:	102695	Length:	1924	Species:	Mus musculus

Alignment Length:	69	Identity:	27/69 - (39%)
Similarity:	36/69 - (52%)	Gaps:	5/69 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    77 GHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDP-ATQMDAGLYEC 140
            |...:|:|.|.|.|:|.|||.|.|.::....: .|.|:   ||...|.:.|.| ..|.|..:|||
Mouse    47 GGVASFVCQATGEPKPRITWMKKGKKVSSQRF-EVIEF---DDGAGSVLRIQPLRVQRDEAIYEC 107

  Fly   141 TADN 144
            ||.|
Mouse   108 TATN 111

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nkt	NP_648450.3	Ig	82..154	CDD:143165	26/64 (41%)
Ptprf	XP_006502927.1	I-set	33..124	CDD:369462	27/69 (39%)
		Ig2_RPTP_IIa_LAR_like	152..232	CDD:319301
		Ig3_RPTP_IIa_LAR_like	252..320	CDD:143216
		FN3	325..414	CDD:238020
		FN3	421..513	CDD:238020
		FN3	518..607	CDD:238020
		FN3	615..709	CDD:238020
		FN3	716..822	CDD:238020
		FN3	827..916	CDD:238020
		FN3	925..1013	CDD:238020
		FN3	1022..>1081	CDD:238020
		PTP_DSP_cys	1352..1627	CDD:391942
		R-PTP-F-2	1629..1919	CDD:350477
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910