powered by:
Protein Alignment nkt and Ptprf
DIOPT Version :9
Sequence 1: | NP_648450.3 |
Gene: | nkt / 39264 |
FlyBaseID: | FBgn0036146 |
Length: | 162 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006502927.1 |
Gene: | Ptprf / 19268 |
MGIID: | 102695 |
Length: | 1924 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 27/69 - (39%) |
Similarity: | 36/69 - (52%) |
Gaps: | 5/69 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 GHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDP-ATQMDAGLYEC 140
|...:|:|.|.|.|:|.|||.|.|.::....: .|.|: ||...|.:.|.| ..|.|..:|||
Mouse 47 GGVASFVCQATGEPKPRITWMKKGKKVSSQRF-EVIEF---DDGAGSVLRIQPLRVQRDEAIYEC 107
Fly 141 TADN 144
||.|
Mouse 108 TATN 111
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.