DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and oig-1

DIOPT Version :9

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_498439.1 Gene:oig-1 / 182450 WormBaseID:WBGene00003859 Length:137 Species:Caenorhabditis elegans


Alignment Length:120 Identity:40/120 - (33%)
Similarity:63/120 - (52%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IGLPITGKYRDPESDQYYNNNNGA-KILQASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDGAE 102
            :.:.|..|....|...:.::.||: ||.::|:|..::.||:|:...|.:.|||||.|.||..|.|
 Worm    17 LSVGINAKSSHIEDLDFTDHTNGSPKISRSSYFKQDFRLGYKLKLFCESSGNPRPQIVWYHRGVE 81

  Fly   103 IYQHLYMHVHEWRIGDDKVKSKIEIDPATQMDAGLYECTADNMYSIDRRSFKTDF 157
            :... :.....:.|..|.|.|.:|:||.:..|.|.|||.|.|:.....:.|.||:
 Worm    82 VNPD-HNRTIRFSIHGDTVSSHLEVDPTSIGDKGEYECVATNLKGSRVKKFLTDY 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig 82..154 CDD:143165 25/71 (35%)
oig-1NP_498439.1 Ig 59..131 CDD:143165 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C1RV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418131at2759
OrthoFinder 1 1.000 - - FOG0008347
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.