DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nkt and ptprd

DIOPT Version :9

Sequence 1:NP_648450.3 Gene:nkt / 39264 FlyBaseID:FBgn0036146 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_017209878.1 Gene:ptprd / 100330629 -ID:- Length:1944 Species:Danio rerio


Alignment Length:86 Identity:30/86 - (34%)
Similarity:41/86 - (47%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VLGHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWRIGDDKVKSKIEIDP-ATQMDAGLY 138
            |.|...:|:|.|.|:|||.|.|.|.|..:....: .|.|:   ||...|.:.|.| .|..|..:|
Zfish    45 VQGGVASFICQASGDPRPKIVWNKKGKRVSNQRF-EVIEF---DDGSGSVLRIQPLRTPRDEAIY 105

  Fly   139 ECTADNMYSIDRRSFKTDFSI 159
            ||.|.|  |:...|..|..::
Zfish   106 ECVASN--SVGETSATTRLTV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nktNP_648450.3 Ig 82..154 CDD:143165 27/72 (38%)
ptprdXP_017209878.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.