Sequence 1: | NP_648449.1 | Gene: | CG7607 / 39263 | FlyBaseID: | FBgn0036145 | Length: | 167 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038966081.1 | Gene: | Ptprf / 360406 | RGDID: | 3453 | Length: | 1928 | Species: | Rattus norvegicus |
Alignment Length: | 157 | Identity: | 36/157 - (22%) |
---|---|---|---|
Similarity: | 59/157 - (37%) | Gaps: | 40/157 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 DLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRKITF 87
Fly 88 FCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANI---------VKSKMEIDPTTQMDAGFY 143
Fly 144 ECQAD-----------NIYAIDRRGFR 159 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |