DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7607 and Ptprf

DIOPT Version :9

Sequence 1:	NP_648449.1	Gene:	CG7607 / 39263	FlyBaseID:	FBgn0036145	Length:	167	Species:	Drosophila melanogaster
Sequence 2:	XP_038966081.1	Gene:	Ptprf / 360406	RGDID:	3453	Length:	1928	Species:	Rattus norvegicus

Alignment Length:	157	Identity:	36/157 - (22%)
Similarity:	59/157 - (37%)	Gaps:	40/157 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 DLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRKITF 87
            :.||.....::.|:.   |.:.|..|:.:.:........|.....|:::.:         |..|.
  Rat   102 EAIYECTATNSLGEI---NTSAKLSVLEEDQLPSGFPTIDMGPQLKVVEKA---------RTATM 154

  Fly    88 FCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANI---------VKSKMEIDPTTQMDAGFY 143
            .|.|.|||.|.|:||||        |..|..:.....|         ::..::|:.:.:.|.|.|
  Rat   155 LCAAGGNPDPEISWFKD--------FLPVDPASSNGRIKQLRSGGSPIRGALQIESSEESDQGKY 211

  Fly   144 ECQAD-----------NIYAIDRRGFR 159
            ||.|.           |:|..|:|..|
  Rat   212 ECVATNSAGTRYSAPANLYVRDQREVR 238

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7607	NP_648449.1	Ig_3	70..149	CDD:404760	23/98 (23%)
		Ig strand B	85..89	CDD:409353	1/3 (33%)
		Ig strand C	98..102	CDD:409353	1/3 (33%)
		Ig strand E	123..132	CDD:409353	1/17 (6%)
		Ig strand F	142..147	CDD:409353	3/4 (75%)
Ptprf	XP_038966081.1	I-set	33..124	CDD:400151	5/24 (21%)
		Ig strand A	33..36	CDD:409353
		Ig strand A'	42..45	CDD:409353
		Ig strand B	50..57	CDD:409353
		Ig strand C	63..68	CDD:409353
		Ig strand C'	71..73	CDD:409353
		Ig strand D	80..84	CDD:409353
		Ig strand E	86..93	CDD:409353
		Ig strand F	103..111	CDD:409353	2/7 (29%)
		Ig strand G	114..124	CDD:409353	3/12 (25%)
		IgI_2_RPTP_IIa_LAR_like	136..232	CDD:409400	27/112 (24%)
		Ig strand B	152..156	CDD:409400	1/3 (33%)
		Ig strand C	165..169	CDD:409400	1/3 (33%)
		Ig strand E	196..200	CDD:409400	0/3 (0%)
		Ig strand F	210..215	CDD:409400	3/4 (75%)
		Ig strand G	222..225	CDD:409400	0/2 (0%)
		IgI_3_RPTP_IIa_LAR_like	245..326	CDD:409401
		Ig strand B	259..263	CDD:409401
		Ig strand C	272..276	CDD:409401
		Ig strand E	293..297	CDD:409401
		Ig strand F	305..310	CDD:409401
		Ig strand G	318..321	CDD:409401
		FN3	329..418	CDD:238020
		FN3	425..517	CDD:238020
		FN3	522..611	CDD:238020
		FN3	619..713	CDD:238020
		FN3	720..826	CDD:238020
		FN3	831..920	CDD:238020
		FN3	929..1017	CDD:238020
		FN3	1026..>1085	CDD:238020
		PTP_DSP_cys	1356..1631	CDD:421693
		R-PTP-F-2	1633..1923	CDD:350477
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910