DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7607 and oig-4

DIOPT Version :9

Sequence 1:NP_648449.1 Gene:CG7607 / 39263 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001022278.1 Gene:oig-4 / 259448 WormBaseID:WBGene00043050 Length:155 Species:Caenorhabditis elegans


Alignment Length:164 Identity:53/164 - (32%)
Similarity:76/164 - (46%) Gaps:35/164 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CLCFLIFGDLIYIAAQRSTAGKTERRNYTGK----------------KPVVIQHRSQDAVNYYDH 63
            |:.|..|    .:.|..|..|   ||...||                :.|:..:||         
 Worm     9 CIFFFCF----LLEAIDSRGG---RRGGKGKGKSNLQFAQVAEFSLVQTVLSDNRS--------- 57

  Fly    64 ENGAKIIKSSHFELDYTLGRKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKS 128
               |:||..|||...|.||.|:...|.|:|:|||||.|:|:|||:........:|..||.:.:.|
 Worm    58 ---AQIITGSHFSQTYRLGYKLLIICKARGDPRPTIKWYKEGAEIQPKASIHYYEKPIENDTIWS 119

  Fly   129 KMEIDPTTQMDAGFYECQADNIYAIDRRGFRTDY 162
            |:|:||.|..|.|.|.|.|:|.:.:..:.|:.:|
 Worm   120 KLEVDPATMGDQGVYACVANNPHGVMAKNFKAEY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig_3 70..149 CDD:404760 35/78 (45%)
Ig strand B 85..89 CDD:409353 0/3 (0%)
Ig strand C 98..102 CDD:409353 2/3 (67%)
Ig strand E 123..132 CDD:409353 2/8 (25%)
Ig strand F 142..147 CDD:409353 2/4 (50%)
oig-4NP_001022278.1 Ig 76..150 CDD:143165 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I5611
eggNOG 1 0.900 - - E1_2C1RV
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I3548
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008347
OrthoInspector 1 1.000 - - otm14697
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.