DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7607 and ptprfa

DIOPT Version :9

Sequence 1:NP_648449.1 Gene:CG7607 / 39263 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_021332435.1 Gene:ptprfa / 140819 ZFINID:ZDB-GENE-020107-2 Length:1918 Species:Danio rerio


Alignment Length:97 Identity:28/97 - (28%)
Similarity:39/97 - (40%) Gaps:28/97 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANI---------VKSKMEIDPTTQM 138
            |..|..|.|.|||.|.|:||||        |..|..:.....|         ::..::|:.:.:.
Zfish   150 RTATMLCAASGNPDPEISWFKD--------FLPVDINSSNGRIKQLRSGGTPIRGALQIENSEES 206

  Fly   139 DAGFYECQA-----------DNIYAIDRRGFR 159
            |.|.|||.|           .|:|..|:|..|
Zfish   207 DQGKYECVAVNSAGTRYSAPANLYVRDQREVR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig_3 70..149 CDD:404760 23/85 (27%)
Ig strand B 85..89 CDD:409353 1/3 (33%)
Ig strand C 98..102 CDD:409353 1/3 (33%)
Ig strand E 123..132 CDD:409353 1/17 (6%)
Ig strand F 142..147 CDD:409353 3/4 (75%)
ptprfaXP_021332435.1 I-set 33..124 CDD:254352
Ig2_RPTP_IIa_LAR_like 152..232 CDD:319301 24/87 (28%)
Ig3_RPTP_IIa_LAR_like 256..324 CDD:143216
FN3 329..418 CDD:238020
FN3 425..517 CDD:238020
FN3 522..610 CDD:238020
fn3 618..705 CDD:306538
FN3 720..816 CDD:238020
FN3 821..902 CDD:238020
FN3 919..1007 CDD:238020
FN3 1017..1086 CDD:238020
PTPc 1388..1617 CDD:238006
PTPc 1678..1908 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.