DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7607 and LOC103911449

DIOPT Version :9

Sequence 1:NP_648449.1 Gene:CG7607 / 39263 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_021333750.1 Gene:LOC103911449 / 103911449 -ID:- Length:135 Species:Danio rerio


Alignment Length:69 Identity:26/69 - (37%)
Similarity:31/69 - (44%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GRKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKSKMEIDP-TTQMDAGFYEC 145
            |...:|.|.|.|:|||.|.|.|.|..:...||..|.|....:.   |.:.|.| .|..|...|||
Zfish    47 GGVASFICQASGDPRPKIVWNKKGKRVSNQRFEVVIEFDDGSG---SVLRIQPLRTPRDEAIYEC 108

  Fly   146 QADN 149
            .|.|
Zfish   109 VASN 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig_3 70..149 CDD:404760 25/67 (37%)
Ig strand B 85..89 CDD:409353 1/3 (33%)
Ig strand C 98..102 CDD:409353 1/3 (33%)
Ig strand E 123..132 CDD:409353 1/8 (13%)
Ig strand F 142..147 CDD:409353 3/4 (75%)
LOC103911449XP_021333750.1 I-set 33..125 CDD:254352 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008347
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.