DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7607 and ptprd

DIOPT Version :9

Sequence 1:NP_648449.1 Gene:CG7607 / 39263 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_017209878.1 Gene:ptprd / 100330629 -ID:- Length:1944 Species:Danio rerio


Alignment Length:70 Identity:23/70 - (32%)
Similarity:33/70 - (47%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RKITFFCMAQGNPRPTITWFKDGAEL---YQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFYE 144
            |..|..|.|.|||.|.|:||||...:   ...|..|:.........::..::|:.:.:.|.|.||
Zfish   150 RTATMLCAASGNPDPDISWFKDFLPVNTSNNGRIKQLRSESFGGTPIRGALQIEQSEESDQGKYE 214

  Fly   145 CQADN 149
            |.|.|
Zfish   215 CVATN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig_3 70..149 CDD:404760 22/68 (32%)
Ig strand B 85..89 CDD:409353 1/3 (33%)
Ig strand C 98..102 CDD:409353 1/3 (33%)
Ig strand E 123..132 CDD:409353 0/8 (0%)
Ig strand F 142..147 CDD:409353 3/4 (75%)
ptprdXP_017209878.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.