powered by:
Protein Alignment CG7607 and ptprd
DIOPT Version :9
Sequence 1: | NP_648449.1 |
Gene: | CG7607 / 39263 |
FlyBaseID: | FBgn0036145 |
Length: | 167 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017209878.1 |
Gene: | ptprd / 100330629 |
-ID: | - |
Length: | 1944 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 23/70 - (32%) |
Similarity: | 33/70 - (47%) |
Gaps: | 3/70 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 RKITFFCMAQGNPRPTITWFKDGAEL---YQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFYE 144
|..|..|.|.|||.|.|:||||...: ...|..|:.........::..::|:.:.:.|.|.||
Zfish 150 RTATMLCAASGNPDPDISWFKDFLPVNTSNNGRIKQLRSESFGGTPIRGALQIEQSEESDQGKYE 214
Fly 145 CQADN 149
|.|.|
Zfish 215 CVATN 219
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.