DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and B3gat1

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001297695.1 Gene:B3gat1 / 76898 MGIID:1924148 Length:347 Species:Mus musculus


Alignment Length:246 Identity:103/246 - (41%)
Similarity:144/246 - (58%) Gaps:16/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TRPTFVAASLPPPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRI 284
            |||...:.:| |.::::||||.||.|.|||||:..||.||.||.|||:|||.:..||....|...
Mouse    87 TRPPPWSDTL-PTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDT 150

  Fly   285 GVPYEYMVAPMPEKYKQTKKAK----PRGVSNRNRGLEYLRE----HATE-GVLYFADDDNTYDI 340
            |:.|.::....|..||....|:    |||...||..|.:|||    ::|: ||:|||||||||.:
Mouse   151 GLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSTQPGVVYFADDDNTYSL 215

  Fly   341 SIFEQMRYISKVAMWPVGLVTKTGVSSPIIQ-AGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKE 404
            .:||:||...:|::|||..|......:|.:. |||:||:...:...|.:.:|||||||:::.:.:
Mouse   216 ELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQ 280

  Fly   405 RPNAQMPF---KPGYEEDGFLRSLAPLDDAEIELLADECRDILTWHTQTKK 452
            |..|....   |.||:|...||.|..|:|  :|..|..|..||.|||:|:|
Mouse   281 RSQAYFKLRGVKGGYQESSLLRELVTLND--LEPKAANCTKILVWHTRTEK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 98/233 (42%)
B3gat1NP_001297695.1 GlcAT-I 97..329 CDD:132995 98/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.