DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and B3gat2

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_072131.1 Gene:B3gat2 / 64544 RGDID:620903 Length:324 Species:Rattus norvegicus


Alignment Length:277 Identity:108/277 - (38%)
Similarity:153/277 - (55%) Gaps:25/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 TTPTASHMENGYKTRPTFVAASLPPPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDAN 271
            ::|.....|...::||........|.:|.|||||.||.|.||||||..|.:.|..|.|:::||..
  Rat    57 SSPGRDAAEKRNESRPQLQPEPRLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDRA 121

  Fly   272 KTNPLVGHTLDRIGVPYEYMVAPMPEKYKQTKKAKPRGVSNRNRGLEYLREH-----ATEGVLYF 331
            ..:.||...|.|.|:|..::..|.|.:||  :...||....||.||.:||:.     |..|||:|
  Rat   122 TRSELVSSFLARAGLPNTHLHVPTPRRYK--RPWLPRATEQRNAGLAWLRQRHQHQSAQPGVLFF 184

  Fly   332 ADDDNTYDISIFEQMRYISKVAMWPVGLVTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDMAGFA 396
            |||||||.:.:|::||...||::||||||.......|:::.||:||:|.||...|.:.:||||||
  Rat   185 ADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVKNGKVVGWYTGWREDRPFAIDMAGFA 249

  Fly   397 VSVKFLKERPNAQMPFK-----PGYEEDGFLRSLAPLDDAEIELLADECRDILTWHTQTKKNAPA 456
            ||::.:...|.|  .||     ||.:|..||:.:..:|  |:|..|:.|..:|.|||:|:|   .
  Rat   250 VSLQVILSNPKA--VFKRRGSQPGMQESDFLKQITTVD--ELEPKANNCTKVLVWHTRTEK---V 307

  Fly   457 QALNRTRYKNTNLEHID 473
            ...|..:|      |:|
  Rat   308 NLANEPKY------HMD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 99/230 (43%)
B3gat2NP_072131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..78 4/20 (20%)
GlcAT-I 81..306 CDD:132995 99/230 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.