DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and b3gat2

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001025524.1 Gene:b3gat2 / 594928 XenbaseID:XB-GENE-921701 Length:331 Species:Xenopus tropicalis


Alignment Length:246 Identity:99/246 - (40%)
Similarity:138/246 - (56%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVPYEYMVAPM 295
            |.:|.|||||.||.|.||||||..|.:.|..|.|:|:||:.....||...|...||...::..|.
 Frog    81 PVIYAITPTYSRPVQKAELTRLANTFRQVPRLHWIVVEDSVHPTELVSRFLAGAGVTSTHLYVPT 145

  Fly   296 PEKYKQTKKAKPRGVSNRNRGLEYLREHATE------------GVLYFADDDNTYDISIFEQMRY 348
            |.:||:|  ..||....||.||.:||:....            ||::||||||||.:.:|::||.
 Frog   146 PRRYKRT--GLPRATEQRNAGLAWLRQEYQRPGLRTAQPQDPTGVVFFADDDNTYSLELFQEMRT 208

  Fly   349 ISKVAMWPVGLVTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPNAQMPFK 413
            ..||::||||||.......|:::.||:|.:|.||...|.:.:||||||||::.:...|.|  .||
 Frog   209 TQKVSVWPVGLVGGRRYERPVVENGKVVSWYTGWRADRPFAIDMAGFAVSLQVILSSPKA--VFK 271

  Fly   414 -----PGYEEDGFLRSLAPLDDAEIELLADECRDILTWHTQTKK----NAP 455
                 ||.:|..||:.:..::  |:|..|:.|..:|.|||:|:|    |.|
 Frog   272 RRGSQPGMQESDFLKQITKVN--ELEPKANNCTKVLVWHTRTEKVNLANEP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 96/237 (41%)
b3gat2NP_001025524.1 GlcAT-I 81..313 CDD:132995 96/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.