DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and b3gat2

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001003454.1 Gene:b3gat2 / 445060 ZFINID:ZDB-GENE-040801-191 Length:316 Species:Danio rerio


Alignment Length:291 Identity:110/291 - (37%)
Similarity:161/291 - (55%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 ITTRTTASGLATTKLSATTRTTAKTSAKLSAATTPTASHMENGYKTRPTFVAASLPPPLYIITPT 239
            ::.|.|||...:...:...|...:|:...|::||.::|...          |.|| |.:|.||||
Zfish    30 LSVRNTASFYLSRLGNVQQRQVVRTTRTSSSSTTASSSGRN----------ATSL-PVIYAITPT 83

  Fly   240 YRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVPYEYMVAPMPEKYKQTKK 304
            |.|..|.||||||..|.:.|....|:|:||||....||...|.|.||.|.::....|.::|:|  
Zfish    84 YSRAVQKAELTRLANTFRQVPQFHWIVVEDANSHTELVSRFLARCGVRYTHLNVFTPRRFKRT-- 146

  Fly   305 AKPRGVSNRNRGLEYLREH---ATEGVLYFADDDNTYDISIFEQMRYISKVAMWPVGLVTKTGVS 366
            ..||....||..|.::|.|   ..:||::||||||||.:.:||:||...:|::||||||......
Zfish   147 GMPRATEQRNLALGWIRGHRGSKDKGVVFFADDDNTYSLELFEEMRSTRRVSVWPVGLVGGRRYE 211

  Fly   367 SPIIQAGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPNA---QMPFKPGYEEDGFLRSLAPL 428
            .|:::.||:||:|.||...|.:.:|||||||:::.:...|.|   :...|||.:|..||:.:..:
Zfish   212 RPLVEKGKVVGWYTGWKADRPFAIDMAGFAVNLQVILSNPRALFKRRGAKPGMQESDFLKQITKV 276

  Fly   429 DDAEIELLADECRDILTWHTQTKK----NAP 455
            :|  :|..|..|..:|.|||:|:|    |.|
Zfish   277 ED--LEPKAKNCTQVLVWHTRTEKVNLGNEP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 94/226 (42%)
b3gat2NP_001003454.1 GlcAT-I 75..298 CDD:132995 94/226 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.