DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and glct-6

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001299964.1 Gene:glct-6 / 4363062 WormBaseID:WBGene00019546 Length:359 Species:Caenorhabditis elegans


Alignment Length:251 Identity:83/251 - (33%)
Similarity:129/251 - (51%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVPYEYMVAPMPE 297
            :.::||||:|..::.::.|:..||.|:.:|.|:::||.|||.|.|...|:|..:||.||      
 Worm   106 IIVVTPTYKRMTRIPDMLRMANTLSHIKDLHWIIVEDGNKTVPAVRDILERTKLPYTYM------ 164

  Fly   298 KYKQTKKAKPRGVSNRNRGLEYLREHAT--------EGVLYFADDDNTYDISIF-EQMRYISKVA 353
            .:|.......||...|...|:|:|.:.:        |||:||.||||:||..:| |.:|.:..:.
 Worm   165 GHKTILGYPRRGWYQRTMALKYIRSNTSQILGKDHEEGVVYFGDDDNSYDTRLFTEYIRNVKTLG 229

  Fly   354 MWPVGLVTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPNAQMPFKPGYEE 418
            :|.||||..|.|.:|.:..||:..:...|...|::.||||||||::|.:.   |:...|....:.
 Worm   230 IWAVGLVGGTVVEAPKVVGGKVTAFNVKWNPKRRFAVDMAGFAVNLKVVL---NSDAVFGTACKR 291

  Fly   419 DGFLRSLAPLDDAEIE--------LLADECRDILTWHTQT--------KKNAPAQA 458
            .|.......|:|..:|        ...|:.|:||.|||:|        .||:..:|
 Worm   292 GGGAPETCLLEDMGLEREDIEPFGYEKDKDREILVWHTKTSTPNIVKSNKNSTKKA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 80/243 (33%)
glct-6NP_001299964.1 Glyco_transf_43 125..330 CDD:281369 72/213 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.