DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and GlcAT-S

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster


Alignment Length:245 Identity:116/245 - (47%)
Similarity:166/245 - (67%) Gaps:9/245 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVPYEYMVAPM 295
            |.:|.:||||.|.||:.|||||.:||.|:..|.|||.:|..|.|..:...|.|.|:|:.:||:||
  Fly   208 PVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADDQEKCNDYMDTLLYRFGMPFTHMVSPM 272

  Fly   296 PEKYKQTKKAKPRGVSNRNRGLEYLREH-ATEGVLYFADDDNTYDISIFEQMRYISKVAMWPVGL 359
            |.|::..|.| ||||:||...|:::|:| .|.|:|||.|||||||:.:|.::|...:|:|:||||
  Fly   273 PSKFRNEKPA-PRGVANRRAALQWIRQHNLTNGILYFGDDDNTYDLRLFSEIRKTQRVSMFPVGL 336

  Fly   360 VTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPNAQMPFKPGYEEDGFLRS 424
            :...|||.|:::.||:|.:.|.|:.||::|||||||||:::::.:.|...||:|||||||.||||
  Fly   337 IADYGVSGPVVRKGKVVAFLDSWVAGRRWPVDMAGFAVNLEYMAQYPYVNMPYKPGYEEDLFLRS 401

  Fly   425 LAPLDDAEIELLADECRDILTWHTQTKKNAPAQALNRTRYKNTNLEHIDR 474
            :. |....||...:.|.:||.||||||    ::.|...|.::..|:  ||
  Fly   402 IG-LQMNLIEPRGNNCTEILVWHTQTK----SKKLGMVRLESKYLD--DR 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 110/221 (50%)
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 109/220 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I2254
eggNOG 1 0.900 - - E1_KOG1476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101124at50557
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 1 1.000 - - mtm1177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
87.920

Return to query results.
Submit another query.