DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and b3gat3

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001015059.2 Gene:b3gat3 / 192334 ZFINID:ZDB-GENE-020419-3 Length:330 Species:Danio rerio


Alignment Length:261 Identity:107/261 - (40%)
Similarity:149/261 - (57%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HMENGYKTRPTFVAASLPPPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLV 277
            |::....::.|.|     |.:|:|||||.|..|.||||||.:|..||..|.|:|:|||.:...||
Zfish    59 HIKTSELSKKTDV-----PRIYVITPTYARLVQKAELTRLSHTFLHVPQLHWIVVEDAPQQTQLV 118

  Fly   278 GHTLDRIGVPYEYMVAPMPEKYK----QTKKAKPRGVSNRNRGLEYLR---------EHAT--EG 327
            ...|...|:.|.::....|::.|    .....||||...||.||.:||         |.|.  |.
Zfish   119 SDFLSASGLTYTHLNKLTPKERKLQEGDPNWLKPRGAEQRNEGLRWLRWMGSTVHGKEAAALEEA 183

  Fly   328 VLYFADDDNTYDISIFEQMRYISKVAMWPVGLVTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDM 392
            |:|||||||||.:.:||:|||..:|::||||||.......|:::.||:|.::.||...|.:|:||
Zfish   184 VVYFADDDNTYSLQLFEEMRYTYRVSVWPVGLVGGMKFERPVVEDGKVVRFHTGWRPNRPFPIDM 248

  Fly   393 AGFAVSVKFL---KER---PNAQMPFKPGYEEDGFLRSLAPLDDAEIELLADECRDILTWHTQTK 451
            ||||||::.:   ||.   .:|||    |:.|..||:.|..:||  :|..||.|..:|.|||:|:
Zfish   249 AGFAVSLRLVLTNKEALFDGDAQM----GFLESSFLQHLVTMDD--LEPKADLCTKVLVWHTRTE 307

  Fly   452 K 452
            |
Zfish   308 K 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 103/241 (43%)
b3gat3NP_001015059.2 GlcAT-I 72..308 CDD:132995 103/241 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.