DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and glct-3

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001364606.1 Gene:glct-3 / 188533 WormBaseID:WBGene00011781 Length:288 Species:Caenorhabditis elegans


Alignment Length:241 Identity:83/241 - (34%)
Similarity:125/241 - (51%) Gaps:38/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVPYEYMVAPMPE 297
            :.:|||||:|..:||::|||..||..|.||.|:||||...|.|.|.:.|:|..:.|.|:.     
 Worm    44 IIVITPTYKRITRLADITRLANTLSQVENLHWIVIEDGESTIPNVQNILERSELLYTYVA----- 103

  Fly   298 KYKQTKKAKP-RGVSNRNRGLEYLR--------EHATEGVLYFADDDNTYDISIFEQ-MRYISKV 352
              .:|....| ||...|:..|:.:|        ||..|.|:|||||||:||:.:||. :|.:.|:
 Worm   104 --HRTASGYPARGWYQRDMALKLIRTNPSQILGEHEGEAVIYFADDDNSYDLRLFEDYIRNVKKL 166

  Fly   353 AMWPVGLVTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPNAQMPF----K 413
            .:|.|||.....|.:|.:...|:..:...|...|::.|||||||:::.::.   |:...|    |
 Worm   167 GLWAVGLAGGAAVEAPNVVNKKVTSFNFKWKSKRRFAVDMAGFAINLDYIL---NSSAVFGTECK 228

  Fly   414 PG--------YEEDGF-LRSLAPLDDAEIELLADECRDILTWHTQT 450
            .|        .|:.|| |..:.|....:     ::..:||.|||:|
 Worm   229 RGDGAPETCLLEDLGFDLNDIEPFGYEK-----EKNNEILVWHTKT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 83/241 (34%)
glct-3NP_001364606.1 Glyco_transf_43 63..269 CDD:397440 72/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.