DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and glct-1

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_493121.2 Gene:glct-1 / 188329 WormBaseID:WBGene00011650 Length:283 Species:Caenorhabditis elegans


Alignment Length:234 Identity:86/234 - (36%)
Similarity:124/234 - (52%) Gaps:24/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVPYEYMVAPMPE 297
            :.:|||||||..::.::|||..||.||.||.|:||||...|.|.|...|:|.|:.|.||.     
 Worm    41 IIVITPTYRRINRMPDITRLSNTLSHVKNLHWIVIEDGVSTVPAVRAVLERTGLSYTYMA----- 100

  Fly   298 KYKQTKKAKPRGVSNRNRGLEYLREHAT--------EGVLYFADDDNTYDISIFEQ-MRYISKVA 353
             :|..:....:|...|...|:::||:.:        |||:|||||||:||:.:|.. :|.:.|:.
 Worm   101 -HKTAQGYPAKGWYQRTMALKFIRENTSRILNTDLREGVVYFADDDNSYDLRLFNDFIRNVRKLG 164

  Fly   354 MWPVGLVTKTGVSSPIIQAGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPNAQMPFK----P 414
            :|.||......|.:|.:...|:..:...|:..|.:.||||||||::|::. |.||.....    .
 Worm   165 VWAVGFAGGAAVEAPKVVDKKVTSFDALWVSKRLFAVDMAGFAVNLKWIL-RTNAVFGKTCNRGD 228

  Fly   415 GYEEDGFLRSLAPLDDAEIELLADE---CRDILTWHTQT 450
            |..|...|..|. .|..:||....|   .|:||.|||:|
 Worm   229 GAPETCLLEDLG-FDLEDIEPFGYEKQNNREILVWHTRT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 86/234 (37%)
glct-1NP_493121.2 Glyco_transf_43 60..265 CDD:281369 75/212 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3459
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.910

Return to query results.
Submit another query.