DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and B3gat1

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_446455.1 Gene:B3gat1 / 117108 RGDID:70880 Length:347 Species:Rattus norvegicus


Alignment Length:246 Identity:103/246 - (41%)
Similarity:144/246 - (58%) Gaps:16/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 TRPTFVAASLPPPLYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRI 284
            |||...:.:| |.::::||||.||.|.|||||:..||.||.||.|||:|||.:..||....|...
  Rat    87 TRPPPWSDTL-PTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDT 150

  Fly   285 GVPYEYMVAPMPEKYKQTKKAK----PRGVSNRNRGLEYLRE----HATE-GVLYFADDDNTYDI 340
            |:.|.::....|..||....|:    |||...||..|.:|||    ::|: ||:|||||||||.:
  Rat   151 GLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSTQPGVVYFADDDNTYSL 215

  Fly   341 SIFEQMRYISKVAMWPVGLVTKTGVSSPIIQ-AGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKE 404
            .:||:||...:|::|||..|......:|.:. |||:||:...:...|.:.:|||||||:::.:.:
  Rat   216 ELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRPFAIDMAGFAVNLRLILQ 280

  Fly   405 RPNAQMPF---KPGYEEDGFLRSLAPLDDAEIELLADECRDILTWHTQTKK 452
            |..|....   |.||:|...||.|..|:|  :|..|..|..||.|||:|:|
  Rat   281 RSQAYFKLRGVKGGYQESSLLRELVTLND--LEPKAANCTKILVWHTRTEK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 98/233 (42%)
B3gat1NP_446455.1 Glyco_transf_43 118..328 CDD:397440 84/211 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101385
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X314
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.