DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlcAT-P and b3gat1

DIOPT Version :9

Sequence 1:NP_001246713.1 Gene:GlcAT-P / 39262 FlyBaseID:FBgn0036144 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001090809.1 Gene:b3gat1 / 100037907 XenbaseID:XB-GENE-961613 Length:347 Species:Xenopus tropicalis


Alignment Length:243 Identity:102/243 - (41%)
Similarity:141/243 - (58%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 PPP-------LYIITPTYRRPEQLAELTRLGYTLKHVVNLLWLVIEDANKTNPLVGHTLDRIGVP 287
            |||       :::|||||.||.|.||||||..||.||.||.|:::||:.:..|||...|...|:.
 Frog    89 PPPWMGNLPIIHVITPTYSRPVQKAELTRLSNTLLHVPNLHWILVEDSQRRTPLVTRLLQDSGLN 153

  Fly   288 YEYMVAPMPEKYK---QTKKAK-PRGVSNRNRGLEYLRE-----HATEGVLYFADDDNTYDISIF 343
            |.::....|..||   .|:..: |||...||..|.:|||     ::..||:|||||||||.:.:|
 Frog   154 YTHLNVETPRNYKLRGDTRDPRIPRGTMQRNLALRWLRETFNRNNSLPGVVYFADDDNTYSLDLF 218

  Fly   344 EQMRYISKVAMWPVGLVTKTGVSSPIIQ-AGKLVGYYDGWIGGRKYPVDMAGFAVSVKFLKERPN 407
            |:||...||::|||..|......||.:. |||:.|:...:...|.:.:||||||::::.:.:||.
 Frog   219 EEMRSTRKVSVWPVAFVGGLRYESPKVNAAGKVFGWKTVFDPHRPFAIDMAGFAINLRLILQRPQ 283

  Fly   408 AQMPF---KPGYEEDGFLRSLAPLDDAEIELLADECRDILTWHTQTKK 452
            |....   |.||:|...||.|..|:|  :|..||.|..||.|||:|:|
 Frog   284 AYFKLRGVKGGYQESSLLRELVTLND--LEPKADNCTKILVWHTRTEK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlcAT-PNP_001246713.1 GlcAT-I 231..452 CDD:132995 100/240 (42%)
b3gat1NP_001090809.1 GlcAT-I 97..329 CDD:132995 98/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3459
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.