DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and AQY1

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_015518.1 Gene:AQY1 / 856322 SGDID:S000006396 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:42/210 - (20%)
Similarity:68/210 - (32%) Gaps:79/210 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 TPGTLLFLYSAVL--TRSMGKVRTDLDSAKSTPLTSSNHEEGSLMIVTLLLTG---RATPYIHNG 234
            |||.:||..|..|  :|:.|.......:|              ::.:|:|:|.   |.|.::   
Yeast   158 TPGEVLFANSLGLGCSRTRGLFLEMFGTA--------------ILCLTVLMTAVEKRETNFM--- 205

  Fly   235 VVNVGDESSYAVPQYGVLKRCMIGLLLWDIESASAA-----VNQSRQPGSRLKTPNYP-----IW 289
                     .|:|         ||:.|:....|..|     ||.:|..|:.:....:|     .|
Yeast   206 ---------AALP---------IGISLFIAHVALTAYTGTGVNPARSLGAAVAARYFPHYHWIYW 252

  Fly   290 ITSCTGHFGVIFNKNPDLLRNYHAESRFDVNYYSCSGHQILMTIDNRTYNEQALVMLERQPITPE 354
            |.:..|                        :..:.|..|:|..:|..||     |..|:...|.|
Yeast   253 IGTLLG------------------------SILAWSVWQLLQILDYTTY-----VTAEKAASTKE 288

  Fly   355 STSMSGKEDGGGATS 369
            .....|:.....|.:
Yeast   289 KAQKKGETSSSSAVA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 42/210 (20%)
AQY1NP_015518.1 MIP 54..266 CDD:273306 31/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.