DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and MINDY4

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_115598.2 Gene:MINDY4 / 84182 HGNCID:21916 Length:757 Species:Homo sapiens


Alignment Length:426 Identity:114/426 - (26%)
Similarity:177/426 - (41%) Gaps:84/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PITAELATDLRNLVFGTAAIPMRAEWLQTSFVFGAPKEELAYGLRSPRNATRGLLSVVQGFVLKY 76
            ||...:|.:::.|:||::......||...||.| :....|.||:...:....|:|:.|||.||:.
Human   406 PIDLSVAKEIKTLLFGSSFCCFNEEWKLQSFSF-SNTASLKYGIVQNKGGPCGVLAAVQGCVLQK 469

  Fly    77 LLFARKTSRVASLTDPLLATADMQREALFCALLEILRTISDKGKVTMVLPSEDEVFVDHSACYFH 141
            |||...:.  |.....|..:...:...|..||.:|:.....:.:..:.|.|..:.| ..:..|..
Human   470 LLFEGDSK--ADCAQGLQPSDAHRTRCLVLALADIVWRAGGRERAVVALASRTQQF-SPTGKYKA 531

  Fly   142 DSVTEKLYVFTLSPNDELEYFLKRNFKYFTEEETP-GTLLFLYSAVLTRSMGKVRTDLDSAKSTP 205
            |.|.|.|.:.:|:..::|..||:::...|  |..| |.:|...||:|:||...:|.|.|...|..
Human   532 DGVLETLTLHSLTCYEDLVTFLQQSIHQF--EVGPYGCILLTLSAILSRSTELIRQDFDVPTSHL 594

  Fly   206 LTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAVPQYGVLKRCMIGLLLWDIESASAA 270
            :.:  |...:..:|.|||||:|...:.|.||.:...........|:..|..||.|     |....
Human   595 IGA--HGYCTQELVNLLLTGKAVSNVFNDVVELDSGDGNITLLRGIAARSDIGFL-----SLFEH 652

  Fly   271 VNQSRQPGSRLKTPNYPIWITSCTGHFGVIFNKNPDLLRNYHAESRFDVNYY---SCSGHQILMT 332
            .|.. |.|..||||.:|||:.....||.::|:..|.|||::..|..||:.||   :....||.:|
Human   653 YNMC-QVGCFLKTPRFPIWVVCSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQEQIRLT 716

  Fly   333 IDNRTYNEQALVMLERQPITPESTSMSGKEDGGGATSPTTVSGGGGAAAGGGVGGASGGVGGAAS 397
            ||                     |:.:..||                                  
Human   717 ID---------------------TTQTISED---------------------------------- 726

  Fly   398 GASGGNDVVAKEESTLNTPLQRLIRTKWEEATISFH 433
               ..||:|        .||:..|||||:.|:::::
Human   727 ---TDNDLV--------PPLELCIRTKWKGASVNWN 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 111/414 (27%)
MINDY4NP_115598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..334
DUF4205 416..752 CDD:290609 111/416 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146964
Domainoid 1 1.000 146 1.000 Domainoid score I4550
eggNOG 1 0.900 - - E1_KOG2871
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42093
orthoMCL 1 0.900 - - OOG6_104874
Panther 1 1.100 - - LDO PTHR12473
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6307
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.