DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and mindy3

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001001204.1 Gene:mindy3 / 407862 XenbaseID:XB-GENE-957056 Length:441 Species:Xenopus tropicalis


Alignment Length:331 Identity:89/331 - (26%)
Similarity:133/331 - (40%) Gaps:73/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AELATDLRNLVFGT-----AAIPMRAEWLQTSFVFGAPKEELAYGLRSPRNATRGLLSVVQGFVL 74
            :|...:|.::|:|.     .|..:...|.| .|||.|.:..   .|.........:|:.||.|:|
 Frog     2 SECDKELVDMVWGRNNSNGLADSVFKRWTQ-GFVFSASEPT---ALEQFEGGPCAVLAPVQAFLL 62

  Fly    75 KYLLFARKTSRVASLTDPLLATADMQREALFCALLEILRTISD-----------KGKVTMVLPSE 128
            |..||..:.|...|..|      :.|:|.|...|.:||..:|.           |.|.|.....|
 Frog    63 KRQLFNTEHSNWRSCQD------EEQKEILCHTLSDILEIVSFNSNSYCLASWLKEKATRETEQE 121

  Fly   129 -----------------DEVFVDHSACYFHDSVTEKLYVFTLSPNDE--LEYFLKRNFKYFTEEE 174
                             :|:..:.    ||.|:.::.: .:||...|  ||.:.....||     
 Frog   122 NPAESSQQNEQPTALAAEELGFER----FHASIQKRKF-NSLSELKEAVLETYSTWRNKY----- 176

  Fly   175 TPGTLLFLYSAVLTRSMGKVRTDLDSAKSTPLTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNV- 238
              |.||||||.:||:.:..|:.:::.|: .||....:..||..::.|||||.|       |.|| 
 Frog   177 --GVLLFLYSVILTKGIENVKNEIEDAE-RPLIDPVYGHGSQSLINLLLTGHA-------VSNVW 231

  Fly   239 -GDESSYAVPQYGVLKRCMIGLLLWDIESASAAVNQSRQPGSRLKTPNYPIWITSCTGHFGVIFN 302
             ||.....:...|:.....:|.|. .:||....     :.||.||:|.:|||:.....|..|.|.
 Frog   232 DGDRECSGMKLQGIHSHADVGFLT-ILESLRFC-----KVGSFLKSPKFPIWVIGSETHLTVFFT 290

  Fly   303 KNPDLL 308
            |...|:
 Frog   291 KEMALV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 87/324 (27%)
mindy3NP_001001204.1 DUF4205 20..312 CDD:404737 85/313 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.