DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and AQP1

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001316801.1 Gene:AQP1 / 358 HGNCID:633 Length:323 Species:Homo sapiens


Alignment Length:411 Identity:78/411 - (18%)
Similarity:129/411 - (31%) Gaps:143/411 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LATDLRNLVFGTAAIPMRAEWLQTS-FVF---GAPKEELAYGLRSP----RNATRGLLSVVQGFV 73
            :|::.:..:|..|.:   ||:|.|: |||   |:     |.|.:.|    :.|.:..:.|...|.
Human     1 MASEFKKKLFWRAVV---AEFLATTLFVFISIGS-----ALGFKYPVGNNQTAVQDNVKVSLAFG 57

  Fly    74 LKYLLFARKTSRVA------SLTDPLLATADMQREALFCALLEILRTISDKGKVTMVLPSEDEVF 132
            |.....|:....::      ::|..||.:..:   ::|.||:.|:.........|.:|       
Human    58 LSIATLAQSVGHISGAHLNPAVTLGLLLSCQI---SIFRALMYIIAQCVGAIVATAIL------- 112

  Fly   133 VDHSACYFHDSVTEKLYVFTLSPNDELEYFLKRNFKYFTEEETPGTLLFLYSAVLTRSMGKVRTD 197
                     ..:|..|...:|..||..:..   |.......|..|||..:...:.|..  :.|.|
Human   113 ---------SGITSSLTGNSLGRNDLADGV---NSGQGLGIEIIGTLQLVLCVLATTD--RRRRD 163

  Fly   198 LDSAKSTPLTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAVPQYGVLKRCMIGLL-- 260
            |..  |.||.                                                 |||.  
Human   164 LGG--SAPLA-------------------------------------------------IGLSVA 177

  Fly   261 ---LWDIESASAAVNQSRQPGSRLKTPNYP----IWITSCTG-------HFGVIFNKNPDL---- 307
               |..|:.....:|.:|..||.:.|.|:.    .|:....|       :..::..::.||    
Human   178 LGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRV 242

  Fly   308 -------LRNYHAESRFDVNYYSCSGHQILMTIDNRTYNEQALVMLERQPITPESTSMSGKEDGG 365
                   :..|..::. |:|..|..|.:|.....:....|:   :.||.|    ..|...:.||.
Human   243 KVWTSGQVEEYDLDAD-DINSRSFLGTKIYQFTHSLEVVEE---VKERDP----PASRPSEHDGR 299

  Fly   366 GA-----------TSPTTVSG 375
            .|           .||..|.|
Human   300 CARKSPLAPKLLTDSPAQVPG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 77/406 (19%)
AQP1NP_001316801.1 NPA 1 76..78 0/1 (0%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.