DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and bib

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster


Alignment Length:356 Identity:72/356 - (20%)
Similarity:116/356 - (32%) Gaps:126/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ASLTDPLLATADMQREALFCALLEILRTISDKGKVTMVLPSEDEVFVDHSACYFHDSVTEKLYVF 151
            ||::..|||||                ..|.....|:.     :.|:..|..:.:.:||..|.|.
  Fly    93 ASVSSVLLATA----------------LASGLAMATLT-----QCFLHISGAHINPAVTLALCVV 136

  Fly   152 -TLSPNDELEYFLKRNFKYFTEEETPGT--LLFLYSAVLTRSMGKVRTDLDSAKSTPLTSSNHEE 213
             ::||        .|...|.|.:...|.  ...||...:....|    :|.:|.|.....:..|.
  Fly   137 RSISP--------IRAAMYITAQCGGGIAGAALLYGVTVPGYQG----NLQAAISHSAALAAWER 189

  Fly   214 -GSLMIVTLLL-------TGRATPYIHNGVVNVGDESSYAVPQYGVLKRCMIGLLLWDIESASAA 270
             |...|:|.|:       |.....::.|...::|...|..         |.:.:         ..
  Fly   190 FGVEFILTFLVVLCYFVSTDPMKKFMGNSAASIGCAYSAC---------CFVSM---------PY 236

  Fly   271 VNQSRQPGSRLKTPNYPI--WITSCTGHFG-------------VIFN-KNPDLLRN--------- 310
            :|.:|..|     |::.:  |.:.....||             .||| :|.:|..|         
  Fly   237 LNPARSLG-----PSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSS 296

  Fly   311 -YHAESRFDVNYYSCSGHQILMTIDNRTYNEQALVMLERQPITPESTSMSGKEDGGGATSPTTVS 374
             .|:|.  ::||.        |.::.....:|:           :.|...|:.:|          
  Fly   297 SIHSED--ELNYD--------MDMEKPNKYQQS-----------QGTYPRGQSNG---------- 330

  Fly   375 GGGGAAAGGGVGGAS--GGVGGAASGASGGN 403
            .|||.|||.|...|:  |.:.|..:.|..||
  Fly   331 NGGGQAAGNGQHQAANMGQMPGVVANAGQGN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 72/356 (20%)
bibNP_001260313.1 MIP 58..273 CDD:278651 44/235 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.