powered by:
Protein Alignment CG14142 and aqp-8
DIOPT Version :9
Sequence 1: | NP_648447.2 |
Gene: | CG14142 / 39261 |
FlyBaseID: | FBgn0036143 |
Length: | 447 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359963.1 |
Gene: | aqp-8 / 180744 |
WormBaseID: | WBGene00000176 |
Length: | 330 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 20/62 - (32%) |
Similarity: | 27/62 - (43%) |
Gaps: | 17/62 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 GGAA---AGGGVGGAS------GGVG-----GAASGASGG--NDVVAKEESTL-NTPLQRLI 421
|.|| |...|||.| .|:| ..|:..||| |..::..:|.| |.|..::|
Worm 37 GNAANIQAAVAVGGNSTSCHIAWGIGFMFAVYLAASVSGGHLNPAISVAQSILGNLPPWKII 98
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14142 | NP_648447.2 |
DUF4205 |
22..433 |
CDD:290609 |
20/62 (32%) |
aqp-8 | NP_001359963.1 |
MIP |
21..261 |
CDD:350945 |
20/62 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2356 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.