powered by:
Protein Alignment CG14142 and aqp-7
DIOPT Version :9
Sequence 1: | NP_648447.2 |
Gene: | CG14142 / 39261 |
FlyBaseID: | FBgn0036143 |
Length: | 447 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379301.1 |
Gene: | aqp-7 / 180589 |
WormBaseID: | WBGene00000175 |
Length: | 302 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 24/68 - (35%) |
Gaps: | 16/68 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 GVLKRCMIGLLLWDIESA-----SAAVNQSRQPGSRL-----------KTPNYPIWITSCTGHFG 298
|.....:.||::..|.:| ...:|.:|..|.|| ...:|..||......||
Worm 198 GAAHPLLFGLVVMMIGTAYGMNLGYPINPARDLGPRLFSFFIYGSGVFSYHSYYFWIPVIAPLFG 262
Fly 299 VIF 301
.||
Worm 263 AIF 265
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14142 | NP_648447.2 |
DUF4205 |
22..433 |
CDD:290609 |
17/68 (25%) |
aqp-7 | NP_001379301.1 |
MIP |
34..273 |
CDD:238204 |
17/68 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2356 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.