DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and aqp-4

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_505512.3 Gene:aqp-4 / 179366 WormBaseID:WBGene00000172 Length:273 Species:Caenorhabditis elegans


Alignment Length:184 Identity:37/184 - (20%)
Similarity:66/184 - (35%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MVLPSEDEVFVDHSACYFHDSVTEKLYVFTLSPNDELEY-FLKRNFKYFTE--EETPGTLLFLYS 184
            ||.|.|::     |...:..|..|:.:....:.|.:..| ..|:.:...|:  .|..|.|.|:|.
 Worm     1 MVSPYEED-----SRPPYMSSYAEETWGQPATTNRKSSYTSRKKEYSLLTKCVAEFLGDLTFVYV 60

  Fly   185 AVLTRSMGKVRTDLDSAKSTP-------LTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNVGDES 242
            ..:..|:.:....:..|....       :|:..|..|          |...|.:...:...|...
 Worm    61 GTMQASLFQYADGILHAAFAHGFTIFILVTAFGHISG----------GHFNPAVSWAIAGAGKMP 115

  Fly   243 SYAVPQYGVLKRCMIGLLLWDIESA---SAAVNQ----SRQPGSRLKTPNYPIW 289
            .:.:|.|      ::..||..|..|   :|.::|    |.:.|:.|.:|....|
 Worm   116 IFHLPFY------VVSQLLGGICGAFLTAAVLSQEQLTSCEAGATLLSPGSQWW 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 37/184 (20%)
aqp-4NP_505512.3 MIP 46..264 CDD:238204 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.