DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and Aqp4

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001304658.1 Gene:Aqp4 / 11829 MGIID:107387 Length:352 Species:Mus musculus


Alignment Length:33 Identity:10/33 - (30%)
Similarity:17/33 - (51%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LYVFTLSPNDELEYFLKRNFKYFTEEETPGTLL 180
            ||.:...|:.||:..||..|.. ..::|.|:.:
Mouse   247 LYEYVFCPDVELKRRLKEAFSK-AAQQTKGSYM 278

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 10/33 (30%)