powered by:
Protein Alignment CG14142 and Aqp2
DIOPT Version :9
Sequence 1: | NP_648447.2 |
Gene: | CG14142 / 39261 |
FlyBaseID: | FBgn0036143 |
Length: | 447 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_033829.3 |
Gene: | Aqp2 / 11827 |
MGIID: | 1096865 |
Length: | 271 |
Species: | Mus musculus |
Alignment Length: | 52 |
Identity: | 17/52 - (32%) |
Similarity: | 24/52 - (46%) |
Gaps: | 12/52 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 DLRNLVFGTAAIPMRAEWLQT-SFVFGAPKEELAYGLRSPRNATRGLLSVVQ 70
:||::.|..|.: ||:|.| .||| :||.|.........||:|
Mouse 3 ELRSIAFSRAVL---AEFLATLLFVF--------FGLGSALQWASSPPSVLQ 43
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2356 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.