DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14142 and aqp8

DIOPT Version :9

Sequence 1:NP_648447.2 Gene:CG14142 / 39261 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001107728.1 Gene:aqp8 / 100135726 XenbaseID:XB-GENE-481926 Length:269 Species:Xenopus tropicalis


Alignment Length:249 Identity:50/249 - (20%)
Similarity:85/249 - (34%) Gaps:74/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 ETPGTLLFLYSAVLTRSMGKVRTDLDSAKSTPLTSSNHEEGSLMIVTLLLTGRATPYIHNGVVN- 237
            |..|:.||:::..|        :.:::|.:|.........|..:.:|:.:.|..:....|..|: 
 Frog    51 ELLGSALFIFAGCL--------SVIENASTTGSLQPALAHGLALGLTIAVLGGISGGHFNPAVSL 107

  Fly   238 ----VGDESSYAVPQYGVLKRC--MIGLLLWDIESASAAVNQSRQPGSRLKTPNYPIWITSCTGH 296
                :|..:...:..|.|.:.|  |||..|  ..:.||..|.....|:...|             
 Frog   108 AAWLIGGLNIILLVPYWVCQLCGGMIGAAL--AMAVSADTNFENATGAAFTT------------- 157

  Fly   297 FGVIFNKNPDLLRNYHAESRFDVNYYSCSGHQILMT------IDNRTYNEQALVMLERQPITPES 355
                       ::|..:.:|       ..|.:|:||      :.....||::     |.|:.|..
 Frog   158 -----------VKNDESVAR-------AIGAEIIMTFFLVFAVCMGAINEKS-----RTPLAPFC 199

  Fly   356 TSMSGKED--GGGATSPTTVSGG---GGAAAGG--------GVGGASGG--VGG 394
            ...:...|  .|||.|...::..   |.|....        .||..:||  |||
 Frog   200 IGFTVTVDILAGGAISGACMNPARAFGPAVVADYWTFHWIYWVGPLAGGLLVGG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 50/249 (20%)
aqp8NP_001107728.1 MIP 48..258 CDD:294134 50/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.