DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck5 and AT5G24810

DIOPT Version :9

Sequence 1:NP_001261705.1 Gene:Adck5 / 39260 FlyBaseID:FBgn0036142 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001190388.1 Gene:AT5G24810 / 832550 AraportID:AT5G24810 Length:1040 Species:Arabidopsis thaliana


Alignment Length:508 Identity:119/508 - (23%)
Similarity:224/508 - (44%) Gaps:90/508 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RFVRSLKTAGLIAADYLRLDENDPEY-ETKVKLL----HKKSAERLLETCLLNGGLYIKVGQGFA 127
            |.::....|.||..||..:.:.:... ::||..|    |.::|:|:|...:...||::|:||..:
plant    56 RRMKVFSIAILIYLDYKGVQQKEKWIKKSKVPALWDKAHDRNAKRVLNLIVELEGLWVKLGQYLS 120

  Fly   128 AINDILPVEYTSTLSLLQDRCLPTTQADVQKVF-------------------------------R 161
            ...|:||..|.|.|:.|||...|....:|.|::                               .
plant   121 TRADVLPQAYISLLTQLQDSLPPRPLQEVCKIYLNVNIRGYTKKEKYFFDIMSMWYDFKVCRTIE 185

  Fly   162 KDFGQLPEEIYQEFDYQPVAAASLAQVFKARLPSGEQVAVKVQYNDLQKRFISDLGTIIFLQDIV 226
            ::.|...:.::.:|..:|:|.||:|||.:|.|.:|:.|.||||::.::...:.||.....:.|.:
plant   186 RELGNSMDVLFTDFVDEPLATASIAQVHRATLANGQDVVVKVQHDGIRAIILEDLKNAKSIVDWI 250

  Fly   227 EFFFKDYNFGWILNDLRKNLVLELNFLQEGQNAER------CAKDMEKFSY-----VHVPKVHWS 280
            .:....|||..::::..|....||:|..|.:|...      |.|..::...     |.:|.:..|
plant   251 AWAEPQYNFNPMIDEWCKEAPRELDFNIEAENTRTVSGNLGCKKTNDEVRSANRVDVLIPDIIQS 315

  Fly   281 YTKTRVLTLEWMDGCKISDLKTIEKEKLSLKDIDVKLFEAFAEQIFYTGFVHADPHPGNIFVRKN 345
              ...||.||:|||.:::|:::::...:..:.|..::..|:|.|||..||.:.||||||..|.|.
plant   316 --SESVLILEYMDGVRLNDVESLDAFGVDKQKIVEEITRAYAHQIFVDGFFNGDPHPGNFLVSKE 378

  Fly   346 RKNGRADIILLDHGLYEELPQNVRGPLCEFWEATVLRQENRMQAAAEKIGI-------------- 396
            .::..   ||||.||.:::..:::..|.:.:.|:....:..:.:|..::|:              
plant   379 PQHRP---ILLDFGLSKKISHSLKQALAKMFLASAEGDQVALLSAFAEMGLKLRLDMPDQAMSVA 440

  Fly   397 ----------GDYMRFAEVLFQQPIRNRGGGIRGKLTQEDID-HMQEIARNNFEHIMGTLKEMPR 450
                      .:.|:..:.|..|.::|.      |:.||.:. :.:|:.|.|      .:...|.
plant   441 GLFFRSSTPSSEAMKTFKTLNDQRVQNM------KVIQEKMQLNQKEVKRFN------PIDAFPG 493

  Fly   451 SMLFVVRNLNTVRAISHQHGDVVNRPRVMARYAQKCLYMQHNRRSPVQYIRWL 503
            .::...|.:|.:|.:|......:....:|..:|:..| :....|.|.....|:
plant   494 DIVIFARVINLLRGLSSTMNVRIVYLDIMRPFAESVL-LGSISRGPTVDAHWI 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck5NP_001261705.1 AarF 98..469 CDD:223733 105/441 (24%)
ADCK1-like 144..395 CDD:270871 73/292 (25%)
AT5G24810NP_001190388.1 AarF 44..536 CDD:223733 116/497 (23%)
ABC1_ADCK3-like 136..421 CDD:270691 72/289 (25%)
Beta-lactamase 558..>846 CDD:278569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D790106at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.