DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck5 and COQ8B

DIOPT Version :9

Sequence 1:NP_001261705.1 Gene:Adck5 / 39260 FlyBaseID:FBgn0036142 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_079152.3 Gene:COQ8B / 79934 HGNCID:19041 Length:544 Species:Homo sapiens


Alignment Length:383 Identity:85/383 - (22%)
Similarity:151/383 - (39%) Gaps:83/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GKRALNGLREANVQKGGRPVL------------RFSLLAAGAGGLAYD---GIVNDFTYCGASVR 68
            |:..:...|||..:|..||.|            |.|.| |..||||..   |::.:.........
Human    55 GEEDIRRAREARPRKTPRPQLSDRSRERKVPASRISRL-ANFGGLAVGLGLGVLAEMAKKSMPGG 118

  Fly    69 FVRSLKTAGLIAADYLRLDENDPEYETKVKLLHKKSAERLLETCLLNGGLYIKVGQGFAAINDIL 133
            .::|...:||.::.:                |.:.:|||:::|.....|..:||||       :|
Human   119 RLQSEGGSGLDSSPF----------------LSEANAERIVQTLCTVRGAALKVGQ-------ML 160

  Fly   134 PVEYTSTLSLLQDRCLPTTQADVQKVFRK-----DF-------GQLPEEIYQEFDYQ-------P 179
            .::..|.:|           ..:|.:|.:     ||       ..|.||:.:::..:       |
Human   161 SIQDNSFIS-----------PQLQHIFERVRQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVP 214

  Fly   180 VAAASLAQVFKARLPSGEQVAVKVQYNDLQKRFISDLGTIIFL----QDIVEFFFKDYNFGWILN 240
            .||||:.||.:..|..|.:||||:||..:.:...||:..::.:    ..:....|.:.:    |.
Human   215 FAAASIGQVHQGLLRDGTEVAVKIQYPGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQS----LQ 275

  Fly   241 DLRKNLVLELNFLQEGQNAERCAKDMEKFSYVHVPKVHWSYTKTRVLTLEWMDGCKISDLKTIEK 305
            .|::.|..|.::.:|...|:...:.:....:..||.|......||||.:|...|..:...:.:.:
Human   276 ALQQELAWECDYRREAACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQ 340

  Fly   306 EKLSLKDIDVKLFEAFAEQIFYTGFVHADPHPGNIFVRKNRKNGRADIILLDHGLYEE 363
            :..:  .|..:|......::|...|:..||:..|.....:..    .:.|||.|...|
Human   341 DLRN--QICFQLLTLCLRELFEFRFMQTDPNWANFLYDASSH----QVTLLDFGASRE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck5NP_001261705.1 AarF 98..469 CDD:223733 65/289 (22%)
ADCK1-like 144..395 CDD:270871 52/243 (21%)
COQ8BNP_079152.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..86 8/30 (27%)
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 155..158 2/2 (100%)
ABC1_ADCK3 175..424 CDD:270872 51/228 (22%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 216..219 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.