DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck5 and coq8b

DIOPT Version :9

Sequence 1:NP_001261705.1 Gene:Adck5 / 39260 FlyBaseID:FBgn0036142 Length:557 Species:Drosophila melanogaster
Sequence 2:XP_021322006.1 Gene:coq8b / 799071 ZFINID:ZDB-GENE-060503-803 Length:656 Species:Danio rerio


Alignment Length:382 Identity:91/382 - (23%)
Similarity:163/382 - (42%) Gaps:65/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQRVRQL-LSLGTRIRGKRALN-GLREANVQKGGRPVLRFSLLAAGAGGLAYD---GIVNDFTYC 63
            :||.|:. .::...:|.|  || ..:|..|     |..|.|.| |..||||..   |.:.:.   
Zfish   186 IQRAREAKQNIARPVRQK--LNERAKERKV-----PATRISRL-ANFGGLAVGLGIGAIAEV--- 239

  Fly    64 GASVRFVRSLKTAGLIAADYLRLDENDPEYETKVKLLHKKSAERLLETCLLNGGLYIKVGQGFAA 128
             |...|.......|.:      ||.         .||.:.:|||::.|.....|..:|:||    
Zfish   240 -AKQSFGGKRSEVGAL------LDS---------PLLSEANAERIVNTLCKVRGAALKIGQ---- 284

  Fly   129 INDILPVEYTS----TLSLLQDRC------LPTTQADVQKVFRKDFGQLPEEIYQEFDYQPVAAA 183
               :|.::..|    .|..:.:|.      :|..|  :.||..::.|....|.....:.:|.|||
Zfish   285 ---MLSIQDNSFINPQLQKIFERVRQSADFMPAWQ--MHKVLEEELGSGWREKLSSIEEKPFAAA 344

  Fly   184 SLAQVFKARLPSGEQVAVKVQYNDLQKRFISDLGTI--IFLQDIV--EFFFKDYNFGWILNDLRK 244
            |:.||....||.|:::|:|:||..:.:...||:..:  :....:|  :..|.|.:    |..|::
Zfish   345 SIGQVHHGVLPGGKEIAMKIQYPGVAESIHSDINNLMSVLKMSVVLPDGLFADSS----LEVLQR 405

  Fly   245 NLVLELNFLQEGQNAERCAKDMEKFSYVHVPKVHWSYTKTRVLTLEWMDGCKISDLKTIEKEKLS 309
            .|..|.::.:|.:.|:|....::......||:|....:..||:|:|.::|..:.  :.::.::.:
Zfish   406 ELAWECDYEREAKCAKRFRNLLKGDPVFVVPEVFDELSARRVITMELVNGVPLD--RCVDLDQET 468

  Fly   310 LKDIDVKLFEAFAEQIFYTGFVHADPHPGNIFVRKNRKNGRADIILLDHGLYEELPQ 366
            ..:|...:.:....::|...|:..||:..|.|....:..    |.|||.|...:.|:
Zfish   469 RNEICFNILQLCLRELFEFRFMQTDPNWSNFFYNSEQNK----IFLLDFGACRDYPE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck5NP_001261705.1 AarF 98..469 CDD:223733 67/283 (24%)
ADCK1-like 144..395 CDD:270871 54/233 (23%)
coq8bXP_021322006.1 ABC1_ADCK3 300..550 CDD:270872 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.