DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck5 and Coq8a

DIOPT Version :9

Sequence 1:NP_001261705.1 Gene:Adck5 / 39260 FlyBaseID:FBgn0036142 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001156762.1 Gene:Coq8a / 67426 MGIID:1914676 Length:645 Species:Mus musculus


Alignment Length:371 Identity:90/371 - (24%)
Similarity:160/371 - (43%) Gaps:66/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RQLLSLGTRIRGKRALNGLREANVQKGGRPVLRFSLLAAGAGGLAYD-GIVNDFTYCGA----SV 67
            :|:||       :||    ||..|     ||.|...| |..||||.. ||       ||    :.
Mouse   191 KQMLS-------ERA----RERKV-----PVTRIGRL-ANFGGLAVGLGI-------GALAEVAK 231

  Fly    68 RFVRSLKTAGLIAADYLRLDENDPEYETKVKLLHKKSAERLLETCLLNGGLYIKVGQGFAAINDI 132
            :.:||..:.|..|.    ||.:        ..|.:.:|||::.|.....|..:|:||..:..:|.
Mouse   232 KSLRSENSTGKKAV----LDSS--------PFLSEANAERIVSTLCKVRGAALKLGQMLSIQDDA 284

  Fly   133 LPVEYTSTLSLLQDRC------LPTTQADVQKVFRKDFGQLPEEIYQEFDYQPVAAASLAQVFKA 191
            .   ....|:.:.:|.      :|..|  :.|....|.|....:..:.|:.:|.||||:.||..|
Mouse   285 F---INPHLAKIFERVRQSADFMPLKQ--MTKTLNSDLGPHWRDKLEYFEERPFAAASIGQVHLA 344

  Fly   192 RLPSGEQVAVKVQYNDLQKRFISDLGTIIFLQD----IVEFFFKDYNFGWILNDLRKNLVLELNF 252
            |:..|.:||:|:||..:.:...||:..::.:.:    :.|..|.::    :::.||:.|.||.::
Mouse   345 RMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEH----LIDVLRRELTLECDY 405

  Fly   253 LQEGQNAERCAKDMEKFSYVHVPKVHWSYTKTRVLTLEWMDGCKISDLKTIEKEKLSLKDIDVKL 317
            .:|...|::..:.::...:.:||::........|||.|.:.|..:...:.:.:|..:  :|...:
Mouse   406 QREAAYAKKFRELLKDHPFFYVPEIVDELCSPHVLTTELISGFPLDQAEGLSQEVRN--EICYNI 468

  Fly   318 FEAFAEQIFYTGFVHADPHPGNIFVRKNRKNGRADIILLDHGLYEE 363
            ......::|....:..||:..|.|....:..    :.|||.|...|
Mouse   469 LVLCLRELFEFHVMQTDPNWSNFFYDPQQHK----VALLDFGATRE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck5NP_001261705.1 AarF 98..469 CDD:223733 63/276 (23%)
ADCK1-like 144..395 CDD:270871 52/230 (23%)
Coq8aNP_001156762.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200 5/19 (26%)
KxGQ motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 273..276 1/2 (50%)
ABC1_ADCK3 292..542 CDD:270872 52/231 (23%)
AAAS motif. /evidence=ECO:0000250|UniProtKB:Q8NI60 334..337 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.