DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adck5 and CG32650

DIOPT Version :9

Sequence 1:NP_001261705.1 Gene:Adck5 / 39260 FlyBaseID:FBgn0036142 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_727647.1 Gene:CG32650 / 326227 FlyBaseID:FBgn0052650 Length:346 Species:Drosophila melanogaster


Alignment Length:254 Identity:48/254 - (18%)
Similarity:85/254 - (33%) Gaps:90/254 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 SGEQVAVKVQYNDLQ-KRFISDLGTIIFLQDIVEFFFKDYNFGWILNDLRKNLVLELNFLQEGQN 258
            |.|....::|:|:|: :|.::||..                    .::|.:..:..|:.|.:.|.
  Fly   108 SREAALRELQWNNLRIRRQLADLVR--------------------CSELGRARISALDRLFQRQT 152

  Fly   259 AE--RCAKDMEKFSYVHVP------KVHWSYTKTRVLTLEWMDGCKI------SDLKTIEKEKLS 309
            .|  .|.:|.|:....|:.      |....|...|.|...|.:..|:      :..|.:|:.:..
  Fly   153 KELVGCRQDHERVLSFHLTKQLEAGKCLQRYRYARDLYASWRELFKMGRHLKEAYKKILERTQSR 217

  Fly   310 LKDIDVKLFEAFAE------------------------------------------QIFYTGFVH 332
            |:..::|. :|..|                                          .:..:|..|
  Fly   218 LEYAEIKR-QALDEMTVAHEMCLGSTRSLLARVRDLELGLAPLGFSRPSVMSRKIGSLGTSGAGH 281

  Fly   333 AD-----PHPGN-IFVRK---NRKNGRADIILLDHGLYEELPQNVRGPLCEFWEATVLR 382
            ||     .|||. ::|:.   .|::.|.  :....|...|||. |..|..:.|...:||
  Fly   282 ADSNRAEEHPGRPVWVKAKAWQRRSYRT--VKFSRGELLELPV-VVPPEAKTWYGKMLR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adck5NP_001261705.1 AarF 98..469 CDD:223733 48/254 (19%)
ADCK1-like 144..395 CDD:270871 48/254 (19%)
CG32650NP_727647.1 DUF4763 30..253 CDD:292582 29/165 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.