powered by:
Protein Alignment IRSp53 and ALG10
DIOPT Version :9
Sequence 1: | NP_729679.2 |
Gene: | IRSp53 / 39258 |
FlyBaseID: | FBgn0052082 |
Length: | 1076 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_116223.3 |
Gene: | ALG10 / 84920 |
HGNCID: | 23162 |
Length: | 473 |
Species: | Homo sapiens |
Alignment Length: | 45 |
Identity: | 13/45 - (28%) |
Similarity: | 21/45 - (46%) |
Gaps: | 5/45 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 GFVLERQCSIAKHWMVYHTTGKTVIDNNFENWQ-EIAASREIIPP 230
||:. ||.:|. |.|: ..|..:.....|.|: |:....:.:||
Human 182 GFMF-RQTNII--WAVF-CAGNVIAQKLTEAWKTELQKKEDRLPP 222
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2642 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.