DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IRSp53 and ALG10

DIOPT Version :10

Sequence 1:NP_729679.2 Gene:IRSp53 / 39258 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_195861.2 Gene:ALG10 / 831764 AraportID:AT5G02410 Length:509 Species:Arabidopsis thaliana


Alignment Length:73 Identity:17/73 - (23%)
Similarity:33/73 - (45%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   870 TLSRTKSNQQQQQQQQFPQSTDEGESDEHGTL--KLSDVNNFFDGEGKNNSHGHG-LVMKTVKRQ 931
            ||..:|...:|:..|:..||:::..:.....|  :.||:::     ..::...|| .|..|....
plant   200 TLDSSKQKGKQEVNQELHQSSNKKGATLRSNLRKRKSDISS-----DTSDPFNHGQTVPSTEDTS 259

  Fly   932 DILKQYYT 939
            |::...||
plant   260 DLVYDIYT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289
SH3_Irsp53_BAIAP2L 364..419 CDD:212713
ALG10NP_195861.2 DIE2_ALG10 25..461 CDD:461481 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.