powered by:
Protein Alignment IRSp53 and Alg10b
DIOPT Version :9
Sequence 1: | NP_729679.2 |
Gene: | IRSp53 / 39258 |
FlyBaseID: | FBgn0052082 |
Length: | 1076 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028613.1 |
Gene: | Alg10b / 380959 |
MGIID: | 2146159 |
Length: | 474 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 14/66 - (21%) |
Similarity: | 27/66 - (40%) |
Gaps: | 7/66 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 183 RRRYGFVLERQCSIAKHWMVYHTTGKTVIDN---NFENWQEIAASREIIP----PAAYESGYSTS 240
:||..|.:....||...|...:.....:.|| .|..|:.:....|::. ||...:|::.:
Mouse 322 KRRVQFSVVTLVSILLVWKFTYVHKYLLADNRHYTFYVWKRVFQRHEVVKYLLVPAYIFAGWAIA 386
Fly 241 N 241
:
Mouse 387 D 387
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2642 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.