DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IRSp53 and PACSIN3

DIOPT Version :9

Sequence 1:NP_729679.2 Gene:IRSp53 / 39258 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_001171903.1 Gene:PACSIN3 / 29763 HGNCID:8572 Length:424 Species:Homo sapiens


Alignment Length:333 Identity:65/333 - (19%)
Similarity:121/333 - (36%) Gaps:103/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 ETNLEKDTKVVQHEQKKFLQQHKVRMESYQKAVSTMKKQRKKKATPENTEKELR--SLQLLEDQK 164
            |::.:.|:.|.| ||.:.||:...|         ..|:..|.||..|.|..||.  :.:.:||. 
Human   171 ESHAKADSAVSQ-EQLRKLQERVER---------CAKEAEKTKAQYEQTLAELHRYTPRYMEDM- 224

  Fly   165 KKLDVFCDQSYKNAMTQERRRYGFVLERQCSIAKHWMVYHTTGKTVID-NNFENWQEIAASREII 228
                   :|:::.....||:|..|..:...::.:|           :| ::.|.:.|:  .|:: 
Human   225 -------EQAFETCQAAERQRLLFFKDMLLTLHQH-----------LDLSSSEKFHEL--HRDL- 268

  Fly   229 PPAAYESGYSTSNGHNNNNISSSSSSGNNNTSGNMRRLERIKDGDDDHLQ------GHGAQLKKS 287
                            :..|.::|                    |::.|:      |.|..:...
Human   269 ----------------HQGIEAAS--------------------DEEDLRWWRSTHGPGMAMNWP 297

  Fly   288 RSIDAPYGDMRTLHERENLSGLGGTGPAHYAQNSL--------PRAKSDFNLALVGTGQSSANKH 344
            :..:......||:..:|.    ||..|......|:        |..:|.   ...||||      
Human   298 QFEEWSLDTQRTISRKEK----GGRSPDEVTLTSIVPTRDGTAPPPQSP---GSPGTGQ------ 349

  Fly   345 KIIEEQLATLGDDQRGDQRPLVKALYAYMPSGENQLSFEEGDRIALVGGK-AKGWQFGENLRTQH 408
               :|:.:.....::......|:|||.|.....::|||..|:.:..:..: .:||..|: |::..
Human   350 ---DEEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQ-LQSGR 410

  Fly   409 FGWFPVAY 416
            .|.:|..|
Human   411 IGLYPANY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289 28/122 (23%)
SH3_Irsp53_BAIAP2L 364..419 CDD:212713 16/54 (30%)
PACSIN3NP_001171903.1 BAR 16..273 CDD:416402 29/149 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..184 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..364 12/68 (18%)
SH3 365..420 CDD:418401 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.