powered by:
Protein Alignment IRSp53 and Alg10
DIOPT Version :9
Sequence 1: | NP_729679.2 |
Gene: | IRSp53 / 39258 |
FlyBaseID: | FBgn0052082 |
Length: | 1076 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_620801.1 |
Gene: | Alg10 / 245960 |
RGDID: | 708500 |
Length: | 474 |
Species: | Rattus norvegicus |
Alignment Length: | 73 |
Identity: | 15/73 - (20%) |
Similarity: | 30/73 - (41%) |
Gaps: | 7/73 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 183 RRRYGFVLERQCSIAKHWMVYHTTGKTVIDN---NFENWQEIAASREIIP----PAAYESGYSTS 240
:||..|.:....|:...|...:.....:.|| .|..|:.:....||:. ||...:|::.:
Rat 322 KRRVQFSVITLVSVFLVWKFTYVHKYLLADNRHYTFYVWKRVFQRHEIVKYLLVPAYMFAGWAVA 386
Fly 241 NGHNNNNI 248
:...:.:|
Rat 387 DSLKSKSI 394
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2642 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.