DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IRSp53 and algn-10

DIOPT Version :9

Sequence 1:NP_729679.2 Gene:IRSp53 / 39258 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_492634.2 Gene:algn-10 / 172855 WormBaseID:WBGene00007043 Length:425 Species:Caenorhabditis elegans


Alignment Length:126 Identity:26/126 - (20%)
Similarity:41/126 - (32%) Gaps:44/126 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 SLPRA----KSDFNLALVGTGQSSANKHKIIEEQLATLGDDQRGDQRPLVKALYAYMPSGENQLS 381
            |||.|    ||||.|     |.|.:..|.:                  |...:|.|:|    :..
 Worm    10 SLPFAAISRKSDFLL-----GASFSCIHVL------------------LTTIVYHYVP----EPY 47

  Fly   382 FEEGDRIALVGGKAKGWQFGENLRTQHFGWFPVAYTNAEVAEVT---TSGGRRYENMLMSY 439
            .:|...|........|          ::.|.|:..|...:..::   ..|..||.|.::.:
 Worm    48 MDEIFHITQTRSYCSG----------NYSWNPLITTPPALYVISMPLCGGNERYANSILLF 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289
SH3_Irsp53_BAIAP2L 364..419 CDD:212713 10/54 (19%)
algn-10NP_492634.2 DIE2_ALG10 45..377 CDD:282739 10/64 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.