| Sequence 1: | NP_729679.2 | Gene: | IRSp53 / 39258 | FlyBaseID: | FBgn0052082 | Length: | 1076 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001013642.2 | Gene: | ALG10B / 144245 | HGNCID: | 31088 | Length: | 473 | Species: | Homo sapiens |
| Alignment Length: | 45 | Identity: | 13/45 - (28%) |
|---|---|---|---|
| Similarity: | 21/45 - (46%) | Gaps: | 5/45 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 187 GFVLERQCSIAKHWMVYHTTGKTVIDNNFENWQ-EIAASREIIPP 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| IRSp53 | NP_729679.2 | I-BAR_IMD | 4..222 | CDD:153289 | 11/35 (31%) |
| SH3_Irsp53_BAIAP2L | 364..419 | CDD:212713 | |||
| ALG10B | NP_001013642.2 | DIE2_ALG10 | 32..427 | CDD:461481 | 13/45 (29%) |
| Blue background indicates that the domain is not in the aligned region. | |||||