DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IRSp53 and ALG10B

DIOPT Version :10

Sequence 1:NP_729679.2 Gene:IRSp53 / 39258 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_001013642.2 Gene:ALG10B / 144245 HGNCID:31088 Length:473 Species:Homo sapiens


Alignment Length:45 Identity:13/45 - (28%)
Similarity:21/45 - (46%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GFVLERQCSIAKHWMVYHTTGKTVIDNNFENWQ-EIAASREIIPP 230
            ||:. ||.:|.  |.|: ..|..:.....|.|: |:....:.:||
Human   182 GFMF-RQTNII--WAVF-CAGNVIAQKLTEAWKTELQKKEDRLPP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289 11/35 (31%)
SH3_Irsp53_BAIAP2L 364..419 CDD:212713
ALG10BNP_001013642.2 DIE2_ALG10 32..427 CDD:461481 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.