DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14143 and CG32074

DIOPT Version :9

Sequence 1:NP_648442.1 Gene:CG14143 / 39256 FlyBaseID:FBgn0036138 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_729676.1 Gene:CG32074 / 317842 FlyBaseID:FBgn0052074 Length:110 Species:Drosophila melanogaster


Alignment Length:115 Identity:105/115 - (91%)
Similarity:106/115 - (92%) Gaps:6/115 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSQLTIFLAIAAFVSTAWALT-SPATVTVSSVTVSSVTIPSVTIPSVTIPTTDTDTSTTSPSAT 64
            ||||.||||||||||||||||| .|||     |||||||||||||||||||||||||||||||||
  Fly     1 MRSQPTIFLAIAAFVSTAWALTIDPAT-----VTVSSVTIPSVTIPSVTIPTTDTDTSTTSPSAT 60

  Fly    65 GSSTTVTPTTKKPKKKATVVHYKKKTHKSNRRRKFRHSRDGKRKNRSSWE 114
            ||||||||||||||||:|||||||||.|||||||||||||||||||||||
  Fly    61 GSSTTVTPTTKKPKKKSTVVHYKKKTQKSNRRRKFRHSRDGKRKNRSSWE 110



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016653
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.