DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd1-like and AT4G15420

DIOPT Version :9

Sequence 1:NP_524023.1 Gene:Ufd1-like / 39254 FlyBaseID:FBgn0036136 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001329347.1 Gene:AT4G15420 / 827213 AraportID:AT4G15420 Length:684 Species:Arabidopsis thaliana


Alignment Length:238 Identity:67/238 - (28%)
Similarity:112/238 - (47%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KCFSVSMLPGNERTDVEKGGKIIMPPSALDTLTRLNV--EYPMLFKLT---NVKKSRSSHAGVLE 81
            :.|......||       |.||.:|||....|:....  :.|:.|:|:   :....:::|:||||
plant   203 RVFQAVSFQGN-------GDKIKLPPSCFTELSDQGAFDKGPLYFELSVVDHADNKKTTHSGVLE 260

  Fly    82 FVADEGKCYLPHWMMENLLLG----EGDILNIESVSLPVATFSKFQPHSTDFLDITNPKAVLENA 142
            |.|::|...||..:..||...    :..::.|..:.||..:::|.||.:..|.|:.|.||:||..
plant   261 FTAEDGTIGLPPHVWSNLFSTHDPMDVPLVEIRYIRLPKGSYAKLQPDNLGFSDLPNHKAILETI 325

  Fly   143 LRNFACLTRGDVIAIKYNKKVYELCVLETKPGNAVSIIECDMNVEFEAPVGYKDHSETQA----- 202
            ||..|.|:..||:.:.|.:..|:|.|||.:|..::|::|.|:.|:..:|....|......     
plant   326 LRQHATLSLDDVLLVNYGQVSYKLQVLELRPATSISVLETDIEVDIVSPDIVSDQPNQHVLKPLQ 390

  Fly   203 -----SGSGQQGA---------AGTVGGEIAGATNAILEEVVE 231
                 ||:.::|.         ..||...:||:...|::..||
plant   391 YGKSESGTVEEGRYDYYKFVIDEATVEKVMAGSVKVIVKVDVE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufd1-likeNP_524023.1 UFD1 4..316 CDD:227469 67/238 (28%)
UFD1 17..190 CDD:281187 55/176 (31%)
AT4G15420NP_001329347.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5140
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12555
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.