DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and RPL2B

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_012246.1 Gene:RPL2B / 854794 SGDID:S000001280 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:51/213 - (23%)
Similarity:81/213 - (38%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GRLV---AKGIGGGIKQQYRWVKWVRDGPTE----------GAQEELVLEVLRDGCRTAKVALVA 125
            ||::   .||.|.......|    :|.|..:          |....:|.:::.|..|.|.:|.|.
Yeast     2 GRVIRNQRKGAGSIFTSHTR----LRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAKVV 62

  Fly   126 VGDELKYILATENMKAGDILKTSRFI-PRIPVRPNEGDAYPLGALPVGTRIHCLEKNPGQMCHLI 189
            ..|..||.|..|...|.:.:.|.:|| .......|.|:..|||::|.||.:..:|:.||....|.
Yeast    63 FRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKPGDRGALA 127

  Fly   190 HAAGTFGTIL--RKFDEKVVVQLPSKREFAFQRTCMATVGRLSNPEHNKEHVGSAQRMREMGNRP 252
            .|:|.:..|:  ...:.|..|:|||..:..........:|.::.                 |.|.
Yeast   128 RASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAG-----------------GGRV 175

  Fly   253 RSGLWKRKEGKHGRKIRR 270
            ...|.|.....|..:::|
Yeast   176 DKPLLKAGRAFHKYRLKR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 21/85 (25%)
Ribosomal_L2_C 161..275 CDD:281880 26/112 (23%)
RPL2BNP_012246.1 RplB 1..252 CDD:424298 51/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.