DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and rpl801

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001342801.1 Gene:rpl801 / 5802952 PomBaseID:SPAC1F7.13c Length:253 Species:Schizosaccharomyces pombe


Alignment Length:249 Identity:58/249 - (23%)
Similarity:90/249 - (36%) Gaps:75/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GRLV-AKGIGGGIKQ----------QYRWVKWV-RDGPTEGAQEELVLEVLRDGCRTAKVALVAV 126
            ||:: |:...|||.|          |.|.:.:. |.|...|    :|.:::.|..|.|.:|.||.
pombe     2 GRVIRAQRKSGGIFQAHTRLRKGAAQLRTLDFAERHGYIRG----VVQKIIHDPGRGAPLAKVAF 62

  Fly   127 GDELKY------ILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCLEKNPGQM 185
            .:...|      .:|||.|..|..:...:     ......|:..|:|.:|.||.|..:|:..|..
pombe    63 RNPYHYRTDVETFVATEGMYTGQFVYCGK-----NAALTVGNVLPVGEMPEGTIISNVEEKAGDR 122

  Fly   186 CHLIHAAGTFGTIL-RKFDE-KVVVQLPSK---------------------------------RE 215
            ..|..::|.:..|: ...|. |..|:|||.                                 .:
pombe   123 GALGRSSGNYVIIVGHDVDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHK 187

  Fly   216 FAFQRTCM-ATVGRLSNP-EH-----NKEHVGSAQRMREMGNRPRSGLWKRKEG 262
            :..:|.|. .|.|...|| :|     |.:|||.:..:      ||.....:|.|
pombe   188 YRVKRNCWPRTRGVAMNPVDHPHGGGNHQHVGHSTTV------PRQSAPGQKVG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 25/90 (28%)
Ribosomal_L2_C 161..275 CDD:281880 33/144 (23%)
rpl801NP_001342801.1 Ribosomal_L2_C 1..251 CDD:332035 58/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.