DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and mrpl2

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001314714.1 Gene:mrpl2 / 571648 ZFINID:ZDB-GENE-050809-12 Length:294 Species:Danio rerio


Alignment Length:225 Identity:109/225 - (48%)
Similarity:146/225 - (64%) Gaps:5/225 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKYTVEPLKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVR----DGPTEGAQEELVLEVLRD 114
            ||||:.|:.:....|||. :||:...|||||.||::|.:.:.|    .|..:....|.||||..|
Zfish    58 EKYTIRPIGMKKTGGRDH-TGRIKTHGIGGGHKQRHRIIDFQRLRSEPGKEQPVMVEKVLEVRYD 121

  Fly   115 GCRTAKVALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCLE 179
            .||:|.:||||.|:..::|:|::||:|||::::.|.|.|:.|...||||:|:|||||||.||.||
Zfish   122 PCRSADIALVAGGNRKRWIIASQNMEAGDLIQSCRGIGRMAVLAQEGDAHPVGALPVGTLIHNLE 186

  Fly   180 KNPGQMCHLIHAAGTFGTILRKFDEKVVVQLPSKREFAFQRTCMATVGRLSNPEHNKEHVGSAQR 244
            ..||:....|.||||.|.:|||.....::|||||.:.....||:|||||:||.:|||..:|.|..
Zfish   187 LFPGRGAQYIRAAGTCGVLLRKVSGTAIIQLPSKHQIQVLETCVATVGRVSNVDHNKRIIGKAGT 251

  Fly   245 MREMGNRPRSGLWKRKEGKHGRKIRRLPPM 274
            .|.:|.||.||.|:||.|..|||||.||.|
Zfish   252 NRWLGIRPSSGRWQRKGGWAGRKIRPLPAM 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 36/82 (44%)
Ribosomal_L2_C 161..275 CDD:281880 63/114 (55%)
mrpl2NP_001314714.1 Ribosomal_L2_C 53..>260 CDD:332035 94/202 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586776
Domainoid 1 1.000 101 1.000 Domainoid score I6944
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69198
Inparanoid 1 1.050 200 1.000 Inparanoid score I3744
OMA 1 1.010 - - QHG46120
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 1 1.000 - - FOG0003807
OrthoInspector 1 1.000 - - oto40551
orthoMCL 1 0.900 - - OOG6_100234
Panther 1 1.100 - - LDO PTHR13691
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1160
SonicParanoid 1 1.000 - - X3165
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.