DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and RpL8

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_524726.1 Gene:RpL8 / 44251 FlyBaseID:FBgn0261602 Length:256 Species:Drosophila melanogaster


Alignment Length:262 Identity:54/262 - (20%)
Similarity:89/262 - (33%) Gaps:86/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVVEKPKPGAGQQFRRTVHFPEKYTVEPLKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRD 97
            :|:...:.|||..|:  .|..::.....|:....|.|   ||.:  :|:                
  Fly     3 RVIRAQRKGAGSVFK--AHVKKRKGAAKLRSLDFAER---SGYI--RGV---------------- 44

  Fly    98 GPTEGAQEELVLEVLRDGCRTAKVALVAVGDELKY------ILATENMKAGDILKTSRFIPRIPV 156
                      |.:::.|..|.|.:|:|...|..:|      .:|.|.|..|..:...|     ..
  Fly    45 ----------VKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGR-----KA 94

  Fly   157 RPNEGDAYPLGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTIL--RKFDEKVVVQLPS--KREFA 217
            ....|:..||..:|.||.|..||:..|....|...:|.:.|::  .:..:|..|:|||  |:...
  Fly    95 TLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVP 159

  Fly   218 FQRTCMATV----GRLSNP-----------------------------EH-----NKEHVGSAQR 244
            .....|..:    ||:..|                             ||     |.:|:|.|..
  Fly   160 SANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGKAST 224

  Fly   245 MR 246
            ::
  Fly   225 VK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 16/84 (19%)
Ribosomal_L2_C 161..275 CDD:281880 29/128 (23%)
RpL8NP_524726.1 PTZ00180 1..256 CDD:173464 54/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 1 1.100 - - P PTHR13691
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.