DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and Rpl8

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_036183.1 Gene:Rpl8 / 26961 MGIID:1350927 Length:257 Species:Mus musculus


Alignment Length:279 Identity:62/279 - (22%)
Similarity:103/279 - (36%) Gaps:89/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVVEKPKPGAGQQFRRTVHFPEKYTVEPLKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRD 97
            :|:...:.|||..||  .|           :.|..|    :.||.|....    :::.::|.:  
Mouse     3 RVIRGQRKGAGSVFR--AH-----------VKHRKG----AARLRAVDFA----ERHGYIKGI-- 44

  Fly    98 GPTEGAQEELVLEVLRDGCRTAKVALVAVGDELKYILATENMKAGDILKTSRFI-PRIPVRPNEG 161
                      |.:::.|..|.|.:|.|...|..::...||...|.:.:.|.:|: .....:.|.|
Mouse    45 ----------VKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG 99

  Fly   162 DAYPLGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTILRKFDE--KVVVQLPS------------ 212
            :..|:|.:|.||.:.|||:.||....|..|:|.:.|::....|  |..|:|||            
Mouse   100 NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRA 164

  Fly   213 ---------------------KREFAFQRTCMATV-GRLSNP-EH-----NKEHVGSAQRMREMG 249
                                 ..::..:|.|...| |...|| ||     |.:|:|....:    
Mouse   165 VVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTI---- 225

  Fly   250 NRPRSGLWKRKEGKHGRKI 268
                     |::...|||:
Mouse   226 ---------RRDAPAGRKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 15/78 (19%)
Ribosomal_L2_C 161..275 CDD:281880 36/150 (24%)
Rpl8NP_036183.1 RplB 1..254 CDD:424298 62/279 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..232 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.