DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL2 and rpl-2

DIOPT Version :9

Sequence 1:NP_524022.1 Gene:mRpL2 / 39253 FlyBaseID:FBgn0036135 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_507940.1 Gene:rpl-2 / 180343 WormBaseID:WBGene00004413 Length:260 Species:Caenorhabditis elegans


Alignment Length:276 Identity:61/276 - (22%)
Similarity:100/276 - (36%) Gaps:83/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RLVAKGIGGGIKQQYRWVKWV----------RDGPTEGAQEELVLEVLRDGCRTAKVALVAVGDE 129
            |:..||.||..|...:..|..          |.|..:|    ||.:::.|..|.|.:|::|..|.
 Worm     6 RIQRKGAGGIFKSHNKHRKGASKLRPLDYAERHGYIKG----LVKDIIHDPGRGAPLAIIAFRDP 66

  Fly   130 LKYILATENMKAGDILKTSRFI-----PRIPVRPNEGDAYPLGALPVGTRIHCLEKNPGQMCHLI 189
            .||......:.|.:.:.|.:||     .:|.:    |:..|:|.||.||.|..:|...|....:.
 Worm    67 YKYKTVKTTVVAAEGMHTGQFIHCGAKAQIQI----GNIVPVGTLPEGTTICNVENKSGDRGVIA 127

  Fly   190 HAAGTFGTIL--RKFDEKVVVQLPSKREFAFQRTCMATVGRLS---------------------- 230
            .|:|.:.|::  ....:|..::|||..:...|....|.:|.::                      
 Worm   128 RASGNYATVIAHNPDTKKTRIRLPSGAKKVVQSVNRAMIGLVAGGGRTDKPLLKAGRSYHKYKAK 192

  Fly   231 ------------NP-EH-----NKEHVGSAQRMREMGNRPRSGLWKRKEGKHGRKI-----RRLP 272
                        || ||     |.:|:|....:             |::...|:|:     ||..
 Worm   193 RNSWPRVRGVAMNPVEHPHGGGNHQHIGHPSTV-------------RRDASAGKKVGLIAARRTG 244

  Fly   273 PMTTISPPAPPKEEAI 288
            .:....|....|||.:
 Worm   245 RIRGGKPVKFTKEENV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL2NP_524022.1 Ribosomal_L2 68..147 CDD:278605 21/81 (26%)
Ribosomal_L2_C 161..275 CDD:281880 32/160 (20%)
rpl-2NP_507940.1 PTZ00180 1..258 CDD:173464 59/272 (22%)
Ribosomal_L2 11..88 CDD:278605 20/80 (25%)
Ribosomal_L2_C 98..224 CDD:281880 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.